ORF ID ENST00000002501.11:116:593
Gene ID ENSG00000003249
Gene Type protein_coding
Gene Symbol DBNDD1
Genomic Location (Chrom: start-end; Strand) chr16:90006334 90019341 ; -
Orf Length (nt) 477
Transcript Length (nt) 2056
Upstream Length (nt) 116
Orf Type canonical
Start Codon ATG
Phylocsf ENSG00000003249
Kozak Sequence and Score 8
Orf Length FDR 0.001
Nucleotide Sequence ATGGAGCCCCCGGAGGGCGCCGGCACCGGAGAGATCGTTAAGGAGGCTGAGGTGCCGCAGGCTGCGCTGGGCGTCCCAGCCCAGGGGACAGGGGACAATGGCCACACGCCTGTGGAGGAGGAGGTCGGGGGCATCCCAGTACCAGCACCGGGGCTCCTGCAGGTCACGGAGAGGAGGCAGCCTCTGAGCAGCGTCTCCTCTCTGGAGGTCCACTTCGACCTCCTGGACCTCACTGAGCTCACCGACATGTCGGACCAGGAGCTGGCCGAGGTCTTTGCTGACTCGGACGACGAGAACCTCAACACCGAGTCCCCAGCAGGTCTGCACCCGCTGCCCCGGGCCGGCTACCTGCGCTCCCCTTCCTGGACGAGGACAAGGGCTGAGCAGAGCCACGAGAAGCAGCCCCTAGGCGACCCCGAGCGGCAGGCCACAGTCCTGGACACGTTTCTCACTGTGGAGAGGCCCCAGGAGGACTAG
Peptide Sequence MEPPEGAGTGEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAPGLLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED
Pfam Domain N
TMHMM.2 Domain Y
Alphafold Predicted Structure N

Peptide cellular Location Predicted by Deeploc

Nucleus Cytoplasm Mitochondrion Golgi Apparatus Endoplasmic Reticulum Membrane Extracellular Cell Membrane LysosomeVacuole Peroxisome Plastid
0.1128 0.8713 0.0013 0.0016 0.0005 0.0204 0.0001 0.0033 0.0051 0.0001 0.0038

TMHMM transmembrane helices Prediction

Domain Start End
outside 1 158

Description

  • Upstream Length: the distance between the transcript start site and the ORF start codon.
  • Start Codon: the start codon type.
  • Phylocsf: the averaged PhyloCSF score of the ORF sequence.
  • Kozak Score: the Kozak Score of sequence around the start codon.
  • Orf Length FDR: XXX
  • PepScore: the calculated PepScore.
  • Expression Level: the expression levels of translated ORFs across different samples (a link to show the Bar plot).
  • Peptide Location Prediction: the DeepLoc.1 predicted peptide cellular localization (a link to the prediction).
  • Pfam Domain: whether the peptide contains a Pfam domain, (Y: a link to the prediction; N: unavailable).
  • TMHMM.2 Domain: whether the peptide contains a TMHMM domain, (Y: a link to the prediction; N: unavailable).
  • Structure Prediction: whether a structure predicted by Alphafold, (Y: a link to the prediction; N: unavailable).
footer logo

Zhe Ji’s Lab

Feinberg School of Medicine

McCormick School of Engineering