ORF ID ENST00000000233.10:89:632
Gene ID ENSG00000004059
Gene Type protein_coding
Gene Symbol ARF5
Genomic Location (Chrom: start-end; Strand) chr7:127588498 127591299 ; +
Orf Length (nt) 543
Transcript Length (nt) 1032
Upstream Length (nt) 89
Orf Type canonical
Start Codon ATG
Phylocsf ENSG00000004059
Kozak Sequence and Score 10
Orf Length FDR 0.001
Nucleotide Sequence ATGGGCCTCACCGTGTCCGCGCTCTTTTCGCGGATCTTCGGGAAGAAGCAGATGCGGATTCTCATGGTTGGCTTGGATGCGGCTGGCAAGACCACAATCCTGTACAAACTGAAGTTGGGGGAGATTGTCACCACCATCCCAACCATAGGCTTCAATGTAGAAACAGTGGAATATAAGAACATCTGTTTCACAGTCTGGGACGTGGGAGGCCAGGACAAGATTCGGCCTCTGTGGCGGCACTACTTCCAGAACACTCAGGGCCTCATCTTTGTGGTGGACAGTAATGACCGGGAGCGGGTCCAAGAATCTGCTGATGAACTCCAGAAGATGCTGCAGGAGGACGAGCTGCGGGATGCAGTGCTGCTGGTATTTGCCAACAAGCAGGACATGCCCAACGCCATGCCCGTGAGCGAGCTGACTGACAAGCTGGGGCTACAGCACTTACGCAGCCGCACGTGGTATGTCCAGGCCACCTGTGCCACCCAAGGCACAGGTCTGTACGATGGTCTGGACTGGCTGTCCCACGAGCTGTCAAAGCGCTAA
Peptide Sequence MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Pfam Domain N
TMHMM.2 Domain Y
Alphafold Predicted Structure N

Peptide cellular Location Predicted by Deeploc

Nucleus Cytoplasm Mitochondrion Golgi Apparatus Endoplasmic Reticulum Membrane Extracellular Cell Membrane LysosomeVacuole Peroxisome Plastid
0.0072 0.0322 0.1648 0.6134 0.0795 0.7763 0.0313 0.0293 0.0281 0.012 0.0023

TMHMM transmembrane helices Prediction

Domain Start End
outside 1 180

Description

  • Upstream Length: the distance between the transcript start site and the ORF start codon.
  • Start Codon: the start codon type.
  • Phylocsf: the averaged PhyloCSF score of the ORF sequence.
  • Kozak Score: the Kozak Score of sequence around the start codon.
  • Orf Length FDR: XXX
  • PepScore: the calculated PepScore.
  • Expression Level: the expression levels of translated ORFs across different samples (a link to show the Bar plot).
  • Peptide Location Prediction: the DeepLoc.1 predicted peptide cellular localization (a link to the prediction).
  • Pfam Domain: whether the peptide contains a Pfam domain, (Y: a link to the prediction; N: unavailable).
  • TMHMM.2 Domain: whether the peptide contains a TMHMM domain, (Y: a link to the prediction; N: unavailable).
  • Structure Prediction: whether a structure predicted by Alphafold, (Y: a link to the prediction; N: unavailable).
footer logo

Zhe Ji’s Lab

Feinberg School of Medicine

McCormick School of Engineering